All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (925)
- (1,939)
- (4,412)
- (1)
- (1)
- (3)
- (1)
- (1,258)
- (1,754)
- (921,451)
- (21,592)
- (2)
- (774)
- (61)
- (1)
- (29)
- (1)
- (5,588)
- (3,360)
- (1,862)
- (218)
- (1)
- (8,787)
- (12,059)
- (2,271)
- (9)
- (52)
- (1)
- (3)
- (4)
- (13)
- (2)
- (69)
- (5)
- (11)
- (12,287)
- (15,876)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,669)
- (535)
- (1)
- (1)
- (136)
- (422)
- (3)
- (1)
- (3)
- (16)
- (110)
- (1)
- (189,995)
- (288,104)
- (1)
- (19)
- (798)
- (1)
- (12,214)
- (2)
- (129)
- (1)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (12)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (19)
- (46)
- (1)
- (5)
- (1)
- (1)
- (10,751)
- (652)
- (1)
- (2)
- (1)
- (4)
- (6)
- (6)
- (1)
- (8)
- (3)
- (16)
- (2)
- (2)
- (329)
- (359)
- (5)
- (13,001)
- (2)
- (4,300)
- (2,250)
- (1)
- (14)
- (33)
- (1)
- (7)
- (1)
- (6,038)
- (3,903)
- (1)
- (20)
- (1)
- (1)
- (2)
- (40)
- (1)
- (2)
- (1)
- (17,537)
- (16,767)
- (18)
- (1)
- (1)
- (1)
- (5,545)
- (3)
- (2)
- (43)
- (4)
- (13)
- (1)
- (164)
- (748)
- (17)
- (2)
- (6)
- (1)
- (1)
- (2)
- (2,085)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (6)
- (2)
- (2)
- (104)
- (1)
- (1)
- (3,865)
- (2)
- (20)
- (3)
- (112)
- (1)
- (1)
- (5)
- (2)
- (3)
- (33)
- (1)
- (5)
- (187)
- (2)
- (4,823)
- (12)
- (1)
- (2)
- (5)
- (9)
- (4)
- (7)
- (23)
- (130)
- (8,934)
- (39,658)
- (448)
- (53)
- (1,929)
- (1)
- (36)
- (7)
- (1)
- (2,681)
- (1)
- (4,478)
- (42)
- (2)
- (2)
- (1)
- (1)
- (4)
- (50)
- (1)
- (1)
- (815)
- (1)
- (1)
- (2)
- (2)
- (32)
- (40)
- (4)
- (6)
- (3)
- (6)
- (1)
- (3)
- (1)
- (3)
- (3)
- (31,161)
- (9)
- (1)
- (29)
- (2,893)
- (74)
- (89)
- (275)
- (2)
- (55)
- (29,965)
- (29,827)
- (6)
- (32,469)
- (16)
- (29,774)
- (45)
- (866)
- (48)
- (595)
- (30,794)
- (1)
- (32,527)
- (1)
- (3)
- (1)
- (73)
- (3)
- (30,317)
- (29,972)
- (3)
- (24,399)
- (24,961)
- (24,935)
- (24,831)
- (24,992)
- (24,794)
- (23)
- (127)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (34,906)
- (11)
- (3)
- (221)
- (761)
- (1,054)
- (721)
- (777)
- (920)
- (889)
- (1,009)
- (850)
- (1,470)
- (910)
- (835)
- (1,058)
- (1,059)
- (1,056)
- (681)
- (1,087)
- (30,490)
- (90)
- (9)
- (42)
- (17)
- (1)
- (103)
- (1)
- (139)
- (3)
- (79)
- (28,930)
- (28,983)
- (29,280)
- (63)
- (28,999)
- (25,597)
- (1)
- (60)
- (28,922)
- (28,575)
- (28,539)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (33,652)
- (5)
- (30)
- (1)
- (1)
- (338)
- (734)
- (30,825)
- (1)
- (30,923)
- (27,238)
- (17,685)
- (17,678)
- (27,221)
- (30,927)
- (38)
- (1)
- (47)
- (9)
- (13)
- (2)
- (99)
- (11)
- (22)
- (58)
- (26)
- (127)
- (158)
- (25)
- (84)
- (58)
- (24)
- (56)
- (75)
- (9)
- (65)
- (73)
- (95)
- (84)
- (78)
- (28)
- (64)
- (70)
- (44)
- (58)
- (50)
- (53)
- (98)
- (122)
- (41)
- (58)
- (65)
- (77)
- (75)
- (454)
- (32,847)
- (7)
- (4)
- (311)
- (417)
- (2,778)
- (3,757)
- (24)
- (3)
- (37)
- (214)
- (2,662)
- (155)
- (41)
- (27,786)
- (558)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (858)
- (142)
- (536)
- (429)
- (878)
- (402)
- (325)
- (815)
- (756)
- (721)
- (2)
- (630)
- (722)
- (290)
- (752)
- (822)
- (634)
- (807)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (11)
- (6)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (542,594)
- (7)
- (266)
- (49)
- (2)
- (367)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,993)
- (30,024)
- (29,977)
- (564)
- (2,894)
- (51)
- (1)
- (15)
- (1,780)
- (726)
- (3)
- (2)
- (6)
- (4)
- (5)
- (111,671)
- (68)
- (123)
- (2,111)
- (31,228)
- (221)
- (8)
- (23)
- (597,679)
- (16)
- (1)
- (800,229)
- (84,197)
- (3)
- (45,150)
- (174)
- (1)
- (1)
- (571)
- (2)
- (36)
- (23)
- (187)
- (1,232)
- (3)
- (4)
- (468)
- (98)
- (1)
- (1,429)
- (3)
- (2)
- (7)
- (2)
- (127)
- (2)
- (9)
- (95)
- (164)
- (51)
- (745)
- (1)
- (5)
- (8,432)
- (7,041)
- (12)
- (2)
- (1)
- (27)
- (27)
- (6)
- (161)
- (292)
- (1)
- (74)
- (2)
- (10,238)
- (43)
- (425)
- (171)
- (2,278)
- (156)
- (6)
- (348)
- (2)
- (1)
- (120)
- (1)
- (9)
- (10)
- (27)
- (84)
- (2)
- (23)
- (1)
- (677)
- (56)
- (8)
- (21)
- (109,131)
- (2)
- (2)
- (57)
- (70)
- (275)
- (18)
- (1,253)
- (6,085)
- (2)
- (7)
- (2)
- (2,152)
- (6)
- (57)
- (432,697)
- (31)
- (20,758)
- (15,649)
- (1,535)
- (377)
- (219)
- (79)
- (10,492)
- (4)
- (170)
- (28)
- (2)
- (28)
- (25)
- (1,047)
- (7)
- (2)
- (9)
- (18)
- (2)
- (1)
- (2)
- (92)
- (10)
- (2)
- (349,499)
- (2,675)
- (43,522)
- (93)
- (2)
- (50)
- (41)
- (1)
- (1)
- (4)
- (167)
- (2)
- (32,414)
- (127)
- (2)
- (1)
- (2)
- (150)
- (893)
- (15,271)
- (3)
- (2)
- (168)
- (30)
- (2)
- (2)
- (10)
- (819)
- (3)
- (2)
- (2)
- (2)
- (2)
- (10)
- (87)
- (64)
- (3)
- (337)
- (1,422)
- (2,837)
- (4)
- (290,181)
- (153,811)
- (191)
- (53)
- (197,229)
- (502,585)
- (77)
- (1,445)
- (43,005)
- (14)
- (267)
- (12,831)
- (529,528)
- (202)
- (609)
- (2)
- (3)
- (551)
- (6)
- (4)
- (211,657)
- (2,647)
- (27)
- (10)
- (51)
- (526)
- (25)
- (270)
- (1,156)
- (1,424)
- (7)
- (8)
- (1,339)
- (4)
- (2)
- (3)
- (26)
- (6,535)
- (1)
- (6)
- (814)
- (32)
- (9)
- (2)
- (434)
- (4)
- (4)
- (2)
- (22)
- (48)
- (1,208)
- (2)
- (16)
- (1,835)
- (1)
- (4)
- (2)
- (261)
- (437)
- (1,280)
- (39)
- (6)
- (43,436)
- (22)
- (1)
- (917)
- (85)
- (835)
- (1,910)
- (5)
- (2)
- (3)
- (2)
- (2)
- (22,381)
- (10)
- (1)
- (4)
- (1,390)
- (9)
- (2)
- (4)
- (135)
- (2)
- (1)
- (2,798)
- (105)
- (3)
- (13)
- (33)
- (1,513)
- (5)
- (2)
- (9,778)
- (4,867)
- (3,679)
- (1)
- (41)
- (11)
- (4,367)
- (2)
- (460)
- (442)
- (4)
- (26)
- (14)
- (52)
- (14)
- (2,642)
- (258)
- (3)
- (1)
- (1)
- (29)
- (13)
- (39)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1,080,888)
- (3)
- (9,440)
- (19)
- (1)
- (51)
- (10)
- (74)
- (3)
- (3)
- (90)
- (40)
- (106)
- (494)
- (5)
- (728)
- (150)
- (62)
- (882)
- (8)
- (35)
- (8)
- (22)
- (5)
- (4)
- (2)
- (867)
- (2)
- (2,269)
- (51)
- (2)
- (5,100)
- (436)
- (1)
- (4)
- (24)
- (3)
- (4)
- (4)
- (8)
- (1)
- (2)
- (19,897)
- (1,027)
- (2,074)
- (426)
- (62)
- (1,190)
- (4)
- (9)
- (53)
- (9)
- (4)
- (47)
- (8)
- (29,697)
- (821)
- (2)
- (2)
- (4)
- (8)
- (5)
- (1,307)
- (9,923)
- (376)
- (1,447)
- (20)
- (855)
- (4)
- (2)
- (30)
- (2)
- (1)
- (1,022)
- (3)
- (9)
- (1)
- (18)
- (3)
- (2)
- (1,266)
- (3,505)
- (371)
- (2)
- (42)
- (5)
- (3)
- (4)
- (3)
- (6)
- (1,889)
- (12)
- (39)
- (4)
- (2,383)
- (164)
- (135)
- (50)
- (1,477)
- (263)
- (2)
- (14)
- (18)
- (1)
- (21)
- (4,674)
- (173)
- (44)
- (1)
- (2)
- (2)
- (5,218)
- (68)
- (578)
- (300)
- (3)
- (108)
- (1)
- (1,572)
- (43)
- (4)
- (2)
- (9)
- (497)
- (21)
- (352)
- (3)
- (3)
- (6)
- (149)
- (145)
- (1)
- (1,779)
- (126)
- (168)
- (42)
- (3)
- (2)
- (176)
- (1)
- (2)
- (36)
- (3,494)
- (218)
- (407)
- (1)
- (274)
- (240)
- (236)
- (160)
- (9)
- (15)
- (11)
- (5)
- (5,223)
- (308)
- (6)
- (10)
- (1)
- (4)
- (52)
- (23)
- (73)
- (2)
- (28)
- (709)
- (1,433,680)
- (695)
- (9)
- (19)
- (1)
- (5)
- (78)
- (519)
- (89)
- (57)
- (15)
- (80)
- (42)
- (441)
- (524)
- (3)
- (15)
- (4)
- (17)
- (107)
- (9)
- (17)
- (2)
- (24)
- (1)
- (24)
- (2)
- (2)
- (16)
- (59)
- (2)
- (18)
- (2)
- (496)
- (8)
- (1)
- (890)
- (1,201)
- (2)
- (8)
- (4)
- (59)
- (139)
- (4)
- (268)
- (1)
- (13)
- (23,997)
- (90)
- (8)
- (2)
- (3)
- (1)
- (571,363)
- (4,877)
- (1,533)
- (1)
- (254)
- (2)
- (3)
- (30)
- (28)
- (8)
- (798)
- (7,444)
- (5)
- (4)
- (46)
- (1,310)
- (23)
- (279)
- (113)
- (1)
- (143)
- (182)
- (1)
- (3)
- (13)
- (20)
- (62)
- (5)
- (6)
- (9)
- (17)
- (207)
- (18)
- (18,491)
- (545)
- (215)
- (25)
- (1,234)
- (6)
- (1)
- (3)
- (1)
- (3)
- (124)
- (11)
- (5)
- (14,722)
- (155)
- (401)
- (10)
- (4)
- (6)
- (62)
- (10,252)
- (532)
- (4)
- (10)
- (2)
- (338,674)
- (5,177)
- (2)
- (6)
- (399)
- (2)
- (33)
- (2,777)
- (1,119)
- (3)
- (10)
- (30)
- (65)
- (153)
- (57)
- (2)
- (247)
- (31)
- (36)
- (3)
- (951)
- (2)
- (5,182)
- (2)
- (1)
- (15)
- (2)
- (22)
- (1)
- (1)
- (2)
- (13)
- (1)
- (2)
- (1)
- (13)
- (3,894)
- (471)
- (1)
- (2)
- (19)
- (5)
- (6)
- (3)
- (9)
- (54)
- (8)
- (3)
- (1)
- (4)
- (87)
- (10)
- (2)
- (24)
- (2)
- (2)
- (42)
- (3)
- (2)
- (2)
- (23)
- (82)
- (2,574)
- (1)
- (8)
- (23)
- (2)
- (3)
- (1,402)
- (6)
- (22)
- (13)
- (4)
- (4)
- (202)
- (5)
- (1,337)
- (38)
- (6)
- (3)
- (19,929)
- (2)
- (50)
- (2)
- (5)
- (3)
- (148)
- (339)
- (183)
- (2,287)
- (1,820)
- (30)
- (16)
- (2)
- (2)
- (4,513)
- (5)
- (9)
Filtered Search Results
Invitrogen™ CD33 Recombinant Mouse Monoclonal Antibody (HIM3-4)
Mouse Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P20138 |
| Isotype | IgG1 κ |
| Concentration | 1 mg/mL |
| Antigen | CD33 |
| Gene Symbols | CD33 |
| Regulatory Status | RUO |
| Purification Method | Protein A/G |
| Gene Alias | CD33; CD33 antigen; CD33 antigen (gp67); CD33 molecule; CD33 molecule transcript; FLJ00391; gp67; Myeloid cell surface antigen CD33; p67; sialic acid binding Ig-like lectin 3; sialic acid-binding Ig-like lectin 3; SIGLEC3; Siglec-3 |
| Gene | CD33 |
| Product Type | Antibody |
| Gene ID (Entrez) | 945 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | HIM3-4 |
Invitrogen™ IRF8 Recombinant Mouse Monoclonal Antibody (GW4CML3), Alexa Fluor™ Plus 488
Mouse Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Alexa Fluor Plus 488 |
| Applications | Flow Cytometry,Western Blot |
| Form | Liquid |
| Gene Accession No. | Q02556 |
| Isotype | IgG1 κ |
| Concentration | 1 mg/mL |
| Antigen | IRF8 |
| Gene Symbols | Irf8 |
| Regulatory Status | RUO |
| Purification Method | Protein A/G |
| Gene Alias | AI893568; H-ICSBP; Icsbp; Icsbp1; IMD32A; IMD32B; interferon consensus sequence binding protein 1; Interferon consensus sequence-binding protein; Interferon regulatory factor 8; Irf8; IRF-8; Myls; transcription factor ICSBP |
| Gene | Irf8 |
| Product Type | Antibody |
| Gene ID (Entrez) | 3394 |
| Formulation | Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.3-7.3 |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | GW4CML3 |
Invitrogen™ L-Thyroxine (T4) Recombinant Mouse Monoclonal Antibody (T4YCH)
Mouse Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Chemical |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Western Blot |
| Form | Liquid |
| Isotype | IgG2b κ |
| Concentration | 1 mg/mL |
| Antigen | L-Thyroxine (T4) |
| Regulatory Status | RUO |
| Purification Method | Protein A/G |
| Gene Alias | C15H11I4NO4; Levothyroxine; L-thyroxine; Synthroid; Thyroxine |
| Product Type | Antibody |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | T4YCH |
Invitrogen™ Ferroportin Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | Q9NP59 |
| Isotype | IgG |
| Concentration | 0.40 mg/mL |
| Antigen | Ferroportin |
| Gene Symbols | SLC40A1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | CAR1; Cell adhesion regulator; duodenal-specific; Dusg; Ferroportin; ferroportin 1; ferroportin-1; Fpn1; Fpt1; HFE4; IREG1; iron regulated gene 1; iron-regulated transporter 1; Metal transporter protein 1; metal transporting protein 1; MST079; MSTP079; MTP; MTP1; Ol5; Pcm; polycythaemia; Slc11a3; SLC11A3 iron transporter; Slc39a1; Slc40a1; solute carrier family 11 (proton-coupled divalent metal ion transporters), member 3; solute carrier family 39 (iron-regulated transporter), member 1; solute carrier family 40 (iron-regulated transporter), member 1; solute carrier family 40 member 1 |
| Gene | SLC40A1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 30061 |
| Formulation | PBS with 40% glycerol and 0.02% sodium azide; pH 7.2 |
| Immunogen | Recombinant protein corresponding to Human SLC40A1. Recombinant protein control fragment (Product #RP-104220). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ IL-1 beta Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P01584, P10749, Q63264 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | IL-1 beta |
| Gene Symbols | IL1B |
| Regulatory Status | RUO |
| Purification Method | Affinity Chromatography |
| Gene Alias | catabolin; cytokine; Hematopoietin 1 (H1); IFN beta inducing factor; il 1b; IL 1β; IL-1; IL1 B; IL-1 beta; IL-1 precursor; IL1B; IL-1B; IL1B1; IL1beta; IL-1beta; IL1-BETA; IL1F2; IL1β; ILN; Interleukin; interleukin 1 beta; Interleukin 1 beta precursor; interleukin 1, beta; interleukin 1, beta 1; interleukin 1-beta; interleukin*1*beta; Interleukin1 beta; interleukin-1 beta; interleukin-1 beta precursor; interleukin-1 beta precursor (AA -113 to 153); interleukin-1 beta proprotein; interleukin-1b; interleukin-1beta; interleukin-beta; LAF; lymphocyte proliferation-potentiating factor; Osteoclast activating factor (OAF); preinterleukin 1 beta; Pro interleukin 1 beta; prointerleukin-1 beta; pro-interleukin-1-beta |
| Gene | IL1B |
| Product Type | Antibody |
| Gene ID (Entrez) | 16176, 24494, 3553 |
| Formulation | PBS with 50% glycerol and 0.09% sodium azide; pH 7.3 |
| Immunogen | Recombinant protein (or fragment). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ PDGF-BB Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Rat,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P01127, Q05028 |
| Isotype | IgG |
| Concentration | 2.58 mg/mL |
| Antigen | PDGF-BB |
| Gene Symbols | PDGFB |
| Regulatory Status | RUO |
| Purification Method | Affinity Chromatography |
| Gene Alias | becaplermin; c-sis; FLJ12858; H-PDGF-BB; IBGC5; PDGF; pdgf protein; PDGF subunit B; PDGF, B chain; PDGF2; PDGF-2; PDGFB; PDGF-B; platelet derived growth factor subunit B; platelet derived growth factor, B polypeptide; platelet-derived growth factor 2; platelet-derived growth factor B; platelet-derived growth factor B chain; platelet-derived growth factor beta; platelet-derived growth factor beta polypeptide; platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); platelet-derived growth factor subunit B; platelet-derived growth factor, beta polypeptide (oncogene SIS); Platelet-derived growth factor, same as Sis (Simian sarcoma viral oncogene homologue, c-sis); proto-oncogene c-Sis; Sis; SSV |
| Gene | PDGFB |
| Product Type | Antibody |
| Gene ID (Entrez) | 24628, 5155 |
| Formulation | PBS with 50% glycerol and 0.05% ProClin 300; pH 7.3 |
| Immunogen | Synthetic peptide. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store undiluted at -20°C. |
|---|---|
| Description | ALG-2 Interacting Protein 1; Alix |
| Target Species | Mouse,Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG1 |
| Research Discipline | Cell Biology |
| Concentration | 250μg/mL |
| Antigen | AIP1 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Formulation | Aqueous buffered solution containing BSA, glycerol, and ≤0.09% sodium azide. |
| Immunogen | Mouse AIP1 aa. 375-580 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 49 |
Invitrogen™ EphB1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | P09759, P54762, Q8CBF3 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | EphB1 |
| Gene Symbols | EPHB1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 9330129L11; AW488255; C130099E04Rik; Cek6; EK6; ELK; Elkh; ELK-related protein tyrosine kinase; ENSMUSG00000074119; Eph receptor B1; Eph receptor B2 (ELK-related protein tyrosine kinase); eph tyrosine kinase 2; EPHB1; Ephb2; EPH-like kinase 6; Ephrin type-B receptor 1; EPHT2; Epth2; Erk; Hek6; NET; Neuronally-expressed EPH-related tyrosine kinase; soluble EPHB1 variant 1; tyrosine-protein kinase receptor EPH-2 |
| Gene | EPHB1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 2047, 24338, 270190 |
| Formulation | PBS with 5mg BSA and 0.05mg sodium azide |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ HTR2A Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | P14842, P28223 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | HTR2A |
| Gene Symbols | Htr2a |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 5-HT-2; 5Ht-2; 5-HT2 receptor; 5-HT2A; 5-HT-2A; 5HT2A Receptor; 5-HT2A receptor; 5-HT2A/2C; 5-HT2A/2C receptor; 5-hydroxytryptamine (serotonin) receptor 2A; 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled; 5-hydroxytryptamine 2 receptor; 5-hydroxytryptamine receptor 2A; E030013E04; Htr2; Htr-2; HTR2A; serotonin 5HT-2 receptor; serotonin 5-HT-2A receptor; serotonin receptor 2A; SR2A |
| Gene | Htr2a |
| Product Type | Antibody |
| Gene ID (Entrez) | 29595, 3356 |
| Formulation | PBS with 5mg BSA and 0.05mg sodium azide |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) . |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ RyR2 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Paraffin),Western Blot |
| Form | Liquid |
| Gene Accession No. | E9Q401, Q92736 |
| Isotype | IgG |
| Concentration | 1.22 mg/mL |
| Antigen | RyR2 |
| Gene Symbols | Ryr2 |
| Regulatory Status | RUO |
| Purification Method | Affinity Chromatography |
| Gene Alias | 9330127I20Rik; ARVC2; ARVD2; calcium release channel; cardiac muscle ryanodine receptor; Cardiac muscle ryanodine receptor-calcium release channel; cardiac ryanodine receptor 2; cardiac-type ryanodine receptor; hRYR-2; islet-type ryanodine receptor; kidney-type ryanodine receptor; Ryanodine receptor; ryanodine receptor 2; ryanodine receptor 2 (cardiac); ryanodine receptor 2, cardiac; ryanodine receptor type 2; ryanodine receptor type II; RyR; RYR2; RYR-2; Type 2 ryanodine receptor; VTSIP |
| Gene | Ryr2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 20191, 6262 |
| Formulation | PBS with 50% glycerol and 0.02% sodium azide; pH 7.3 |
| Immunogen | Synthetic peptide. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ ITGA7 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry,Western Blot |
| Form | Liquid |
| Gene Accession No. | Q13683 |
| Isotype | IgG |
| Concentration | 2 mg/mL |
| Antigen | ITGA7 |
| Gene Symbols | Itga7 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography, Protein A |
| Gene Alias | [a]7; alpha 7A integrin; alpha7; H36-alpha7; integrin alpha 7; integrin alpha 7 chain; integrin alpha-7; Integrin alpha-7 70 kDa form; Integrin alpha-7 heavy chain; Integrin alpha-7 light chain; integrin subunit alpha 7; integrin, alpha 7; ITGA7; UNQ406/PRO768 |
| Gene | Itga7 |
| Product Type | Antibody |
| Gene ID (Entrez) | 3679 |
| Formulation | PBS with 0.09% sodium azide; pH 7.4 |
| Immunogen | KLH conjugated synthetic peptide between 247-279 amino acids from the N-terminal region of human ITGA7. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P04117, P15090 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | FABP4 |
| Gene Symbols | FABP4 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 3T3-L1 lipid-binding protein; 422/aP2; adipocyte fatty acid binding protein; Adipocyte lipid binding protein; adipocyte lipid-binding protein; adipocyte protein aP2; adipocyte-type fatty acid-binding protein; AFABP; A-FABP; ALBP; ALBP/Ap2; Ap2; epididymis secretory protein Li 104; FABP4; fatty acid binding protein 4; Fatty acid binding protein 4 adipocyte; fatty acid binding protein 4, adipocyte; fatty acid-binding protein 4; Fatty acid-binding protein, adipocyte; HEL S 104; HEL-S-104; Lbpl; myelin P2 protein homolog; P15; P2 adipocyte protein; Protein 422 |
| Gene | FABP4 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11770, 2167 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Recombinant protein corresponding to amino acids 1-132 of human adipocyte-type fatty acid-binding protein. |
| Classification | Recombinant Superclonal |
| Primary or Secondary | Primary |
| Clone | 2HCLC |
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Rat,Canine,Monkey |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ChIP Assay,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | Q96MM3 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | Rex1 |
| Gene Symbols | ZFP42 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 1700021P10Rik; 2610511M11Rik; AW050347; ELOABP1; EloA-BP1; elongin A binding protein 1; elongin A-binding protein 1; elongin-A-binding protein 1; hREX-1; KIAA1138; mREX-1; reduced expression protein 1; REX1; Rex-1; REX1 transcription factor; REX1, RNA exonuclease 1 homolog; REX1, RNA exonuclease 1 homolog (S. cerevisiae); REXO1; RNA exonuclease 1 homolog; Tceb3bp1; transcription elongation factor B polypeptide 3 binding protein 1; transcription elongation factor B polypeptide 3-binding protein 1; Zfp42; Zfp-42; ZFP42 zinc finger protein; Zfp971; Zinc finger protein 42; zinc finger protein 42 homolog; Zinc finger protein 754; zinc finger protein 971; ZNF754 |
| Gene | ZFP42 |
| Product Type | Antibody |
| Gene ID (Entrez) | 100361947, 100856057, 132625 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Recombinant protein corresponding to amino acids 1-140 of human REX1 transcription factor. |
| Classification | Recombinant Superclonal |
| Primary or Secondary | Primary |
| Clone | 14HCLC |
Invitrogen™ Phospho-Rb (Thr821) Recombinant Superclonal™ Antibody (16HCLC)
Rabbit Recombinant Superclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P06400 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | Phospho-Rb (Thr821) |
| Gene Symbols | RB1 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | Cleaved Rb; delta RB-p70; DRb-p70; exon 17 tumor GOS561 substitution mutation causes premature stop; GOS563 exon 17 substitution mutation causes premature stop; OSRC; p104; p104 chicken Rb; P105RB; p105-Rb; Phospho-Retinoblastoma; pp105; pp110; PPP1R130; pRb; prepro-retinoblastoma-associated protein; protein phosphatase 1, regulatory subunit 130; rb; RB transcriptional corepressor 1; RB1; Rb-1; Rb-p70; Retin; Retinoblastoma; retinoblastoma 1; retinoblastoma 1 (including osteosarcoma); retinoblastoma 1 protein; retinoblastoma gene; retinoblastoma isoform A; retinoblastoma protein; retinoblastoma suspectibility protein; retinoblastoma tumor suppressor; retinoblastoma-associated protein |
| Gene | RB1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 5925 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Phosphopeptide corresponding to amino acids 817-825 of human Retinoblastoma [pT821]. |
| Classification | Recombinant Superclonal |
| Primary or Secondary | Primary |
| Clone | 16HCLC |
Invitrogen™ Glucagon Recombinant Superclonal™ Antibody (3HCLC)
Rabbit Recombinant Superclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Monkey |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Liquid |
| Gene Accession No. | P01275 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | Glucagon |
| Gene Symbols | Gcg |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | GCG; Glicentin; Glicentin-related polypeptide; GLP1; GLP-1; GLP-1(7-36); GLP-1(7-37); GLP1/2; GLP2; GLP-2; Glu; glucagon; Glucagon-like peptide 1; Glucagon-like peptide 1(7-36); Glucagon-like peptide 1(7-37); Glucagon-like peptide 2; glucagon-like peptide-1; GRPP; IL12p35; IL12P40; Incretin hormone; OXM; OXY; Oxyntomodulin; porcine proglucagon; PPG; preproglucagon; proglucagon |
| Gene | Gcg |
| Product Type | Antibody |
| Gene ID (Entrez) | 2641 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2-7.4 |
| Immunogen | Peptide corresponding to amino acids 53-81 of human Glucagon. |
| Classification | Recombinant Superclonal |
| Primary or Secondary | Primary |
| Clone | 3HCLC |